PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G16140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 291aa    MW: 32510.6 Da    PI: 8.5554
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G16140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.51.3e-3170120151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                   krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  OB05G16140.1  70 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 120
                   79***********************************************95 PP

2K-box97.91.5e-321362342100
         K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   ++ss++ ++e +a+++qqe+akLk +i +Lq+++R l G++++++s+++L++Le +L+k+l kiR++Knell+++ie++q++e elq++n +L++k+
  OB05G16140.1 136 DTSSTSTVAEINAQHYQQESAKLKLQITTLQNSNRTLGGDNITTMSHRDLKHLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNDNLYLKSKV 232
                   55677779****************************************************************************************9 PP

         K-box  99 ee 100
                   +e
  OB05G16140.1 233 AE 234
                   86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.1E-4162121IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.31962122IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-3363135IPR002100Transcription factor, MADS-box
CDDcd002652.06E-4563139No hitNo description
PROSITE patternPS00350064118IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-336484IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2671118IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-338499IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-3399120IPR002100Transcription factor, MADS-box
PfamPF014863.6E-23147232IPR002487Transcription factor, K-box
PROSITE profilePS5129713.878148238IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MQDCSFSPVI REKLANMHIY EEQGAEPSTG LMMNEAAAAA AAAAASPGSG GSGSAGAAEK  60
TAGRGKIEIK RIENTTNRQV TFCKRRNGLL KKAYELSVLC DAEVALIVFS SRGRLYEYSN  120
NSVKATIERY KKANSDTSST STVAEINAQH YQQESAKLKL QITTLQNSNR TLGGDNITTM  180
SHRDLKHLEG RLDKGLGKIR ARKNELLCAE IEYMQRREME LQNDNLYLKS KVAESERGLQ  240
TVNMMGAAST SEYVQNMVHY DPRNLLQFNI MQQPQYYTEQ EDRKAFISDE R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-2063134172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-2063134172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-2063134172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-2063134172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-2063134172Myocyte-specific enhancer factor 2A
3p57_I3e-2063134172Myocyte-specific enhancer factor 2A
3p57_D3e-2063134172Myocyte-specific enhancer factor 2A
3p57_C3e-2063134172Myocyte-specific enhancer factor 2A
3p57_B3e-2063134172Myocyte-specific enhancer factor 2A
3p57_A3e-2063134172Myocyte-specific enhancer factor 2A
3kov_J3e-2063134172Myocyte-specific enhancer factor 2A
3kov_I3e-2063134172Myocyte-specific enhancer factor 2A
3kov_B3e-2063134172Myocyte-specific enhancer factor 2A
3kov_A3e-2063134172Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2321570.0AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBankFJ7509420.0FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654143.10.0PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-169MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLJ3M4U00.0J3M4U0_ORYBR; Uncharacterized protein
STRINGOB05G16140.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.14e-96MIKC_MADS family protein